Lineage for d4xaua_ (4xau A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1867292Species Actinomadura melliaura [TaxId:360723] [269170] (3 PDB entries)
  8. 1867297Domain d4xaua_: 4xau A: [269181]
    automated match to d1mdza_
    complexed with plp

Details for d4xaua_

PDB Entry: 4xau (more details), 3 Å

PDB Description: crystal structure of ats13 from actinomadura melliaura
PDB Compounds: (A:) Putative aminotransferase

SCOPe Domain Sequences for d4xaua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xaua_ c.67.1.0 (A:) automated matches {Actinomadura melliaura [TaxId: 360723]}
gshmiplfkvavsptaldrvaevfasgylgqgprvaefesalaarlgnprvvsvhsgtsg
lclalrlldapeerdevlstpltfeatnwailadgrritwvdvdpatltmdlddlerkis
patraiivvhwtgypvdldrlagildraerehgfrpaviedcahawgasyrgvplgshgn
mcvfsfqalkhltcgdgglltlpgdelheramlrrfygidrtadrlrgaydvaewglkwh
mtdlnaaiglanletvdeqlrlhrenaafydkeltgvpglellqrspdregsfyvydvkv
ddrpafhrkmeaagimaglvsrrndehscvahlrtslpgldsvydrmvslpvgwwlteqd
rehvvatirsgw

SCOPe Domain Coordinates for d4xaua_:

Click to download the PDB-style file with coordinates for d4xaua_.
(The format of our PDB-style files is described here.)

Timeline for d4xaua_: