SCOPe 2.07: Domain d4xaub1: 4xau B:1-369

Lineage for d4xaub1 (4xau B:1-369)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Actinomadura melliaura [TaxId:360723] [269170] (2 PDB entries)

8. Domain d4xaub1: 4xau B:1-369 [269180]
   Other proteins in same PDB: d4xaua2, d4xaub2, d4xauc2, d4xaud2, d4xaue2, d4xauf2, d4xaug2
   automated match to d1mdza_
   complexed with plp

Details for d4xaub1

PDB Entry: 4xau, 3 Å

PDB Description: crystal structure of ats13 from actinomadura melliaura

PDB Compounds: (B:) Putative aminotransferase

SCOPe Domain Sequences for d4xaub1:

Sequence; same for both SEQRES and ATOM records:

>d4xaub1 c.67.1.0 (B:1-369) automated matches {Actinomadura melliaura [TaxId: 360723]}
miplfkvavsptaldrvaevfasgylgqgprvaefesalaarlgnprvvsvhsgtsglcl
alrlldapeerdevlstpltfeatnwailadgrritwvdvdpatltmdlddlerkispat
raiivvhwtgypvdldrlagildraerehgfrpaviedcahawgasyrgvplgshgnmcv
fsfqalkhltcgdgglltlpgdelheramlrrfygidrtadrlrgaydvaewglkwhmtd
lnaaiglanletvdeqlrlhrenaafydkeltgvpglellqrspdregsfyvydvkvddr
pafhrkmeaagimaglvsrrndehscvahlrtslpgldsvydrmvslpvgwwlteqdreh
vvatirsgw

Timeline for d4xaub1:

• d4xaub1 first appeared in SCOPe 2.05, called d4xaub_
  
• d4xaub1 appears in SCOPe 2.06
  
• d4xaub1 appears in the current release, SCOPe 2.08