Lineage for d4xckb_ (4xck B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904617Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2904618Protein automated matches [190117] (50 species)
    not a true protein
  7. 2904975Species Vibrio cholerae [TaxId:345073] [269172] (7 PDB entries)
  8. 2904985Domain d4xckb_: 4xck B: [269178]
    automated match to d1rk2b_
    complexed with adp, cs, rib

Details for d4xckb_

PDB Entry: 4xck (more details), 2.37 Å

PDB Description: vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion.
PDB Compounds: (B:) ribokinase

SCOPe Domain Sequences for d4xckb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xckb_ c.72.1.0 (B:) automated matches {Vibrio cholerae [TaxId: 345073]}
mnklvvlgsvnadhvlqvpsfprpgetlhgrnyqvipggkganqavaaarmqadvgfiac
vgddsfginiresfkldgintagvklqpncptgiamiqvsdsgensicisaeanakltaa
aiepdlaairdaryllmqletpldgilkaaqeaktaktnvilnpaparelpdellkcvdl
itpneteaevltgitvyddssaqqaadalhckgieiviitlgskgvwlsqngrgqripgf
vvkatdttaagdtfngalvtgllqemplesaikfahaaaaisvtrfgaqtsiptraevea
flaehs

SCOPe Domain Coordinates for d4xckb_:

Click to download the PDB-style file with coordinates for d4xckb_.
(The format of our PDB-style files is described here.)

Timeline for d4xckb_: