Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Type I TGF-beta receptor R4 [56144] (1 species) TKL group; STKR subfamily; serine/threonine kinase; possible evolutionary link to tyrosine kinases |
Species Human (Homo sapiens) [TaxId:9606] [56145] (16 PDB entries) Uniprot P36897 200-500 ! Uniprot P36897 201-503 |
Domain d4x2ja_: 4x2j A: [269169] automated match to d1vjya_ complexed with 3wn, so4 |
PDB Entry: 4x2j (more details), 1.69 Å
SCOPe Domain Sequences for d4x2ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4x2ja_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} gtiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhen ilgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhm eivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkry mapevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsv eemrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqq egi
Timeline for d4x2ja_: