Lineage for d4x8ra_ (4x8r A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916084Species Rhodobacter sphaeroides [TaxId:349101] [257489] (2 PDB entries)
  8. 2916086Domain d4x8ra_: 4x8r A: [269161]
    automated match to d4ovsa_
    complexed with bdp, po4

Details for d4x8ra_

PDB Entry: 4x8r (more details), 1.9 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
PDB Compounds: (A:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4x8ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x8ra_ c.94.1.0 (A:) automated matches {Rhodobacter sphaeroides [TaxId: 349101]}
ecevtlrssdthpdgyptvegvkfmaerakelsngricievfpssqlgeekdtieqtqfg
vidmvrasfgsfndivpeaqllslpylfrseehlhnvmdgpigdelakafeakdliavay
ydggsrsfynsqkpitkvedlkgmkfrvmqsdvfvdmmsalganatpmpygevyssiqtg
vidgaennwpsydssghfevakyytldqhlmvpelvaiskikwdalspedqqvlrqaaee
sepvqrklwaeqekaseekvvasgaevvreidktpfieamapvyekyvtkseyqdlvkri
qetq

SCOPe Domain Coordinates for d4x8ra_:

Click to download the PDB-style file with coordinates for d4x8ra_.
(The format of our PDB-style files is described here.)

Timeline for d4x8ra_: