SCOPe 2.08: Domain d1aa6a1: 1aa6 A:565-715

Lineage for d1aa6a1 (1aa6 A:565-715)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
   barrel, closed; n=6, S=10; complex topology with crossover (psi) loops

4. Superfamily b.52.2: ADC-like [50692] (4 families)

5. Family b.52.2.2: Formate dehydrogenase/DMSO reductase, C-terminal domain [50696] (10 proteins)
   molybdopterine enzyme

6. Protein Formate dehydrogenase H [50700] (1 species)

7. Species Escherichia coli [TaxId:562] [50701] (4 PDB entries)

8. Domain d1aa6a1: 1aa6 A:565-715 [26916]
   Other proteins in same PDB: d1aa6a2
   complexed with 4mo, mgd, sf4
   has additional insertions and/or extensions that are not grouped together

Details for d1aa6a1

PDB Entry: 1aa6, 2.3 Å

PDB Description: reduced form of formate dehydrogenase h from e. coli

PDB Compounds: (A:) formate dehydrogenase h

SCOPe Domain Sequences for d1aa6a1:

Sequence, based on SEQRES records:

>d1aa6a1 b.52.2.2 (A:565-715) Formate dehydrogenase H {Escherichia coli [TaxId: 562]}
pidkltdeypmvlstvrevghyscrsmtgncaalaaladepgyaqintedakrlgiedea
lvwvhsrkgkiitraqvsdrpnkgaiymtyqwwigacnelvtenlspitktpeykycavr
vepiadqraaeqyvideynklktrlreaala

Sequence, based on observed residues (ATOM records):

>d1aa6a1 b.52.2.2 (A:565-715) Formate dehydrogenase H {Escherichia coli [TaxId: 562]}
pidkltdeypmvlstvrevghyscrsmtgncaalaaladepgyaqintedakrlgiedea
lvwvhsrkgkiitraqvsdrpnkgaiymtyqwwpeykycavrvepiadqraaeqyvidey
nklktrlreaala

Timeline for d1aa6a1:

• d1aa6a1 first appeared (with stable ids) in SCOP 1.55, called d1aa6_1
  
• d1aa6a1 appears in SCOPe 2.07