Lineage for d4wqpa_ (4wqp A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1747085Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1747086Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1748271Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 1748272Protein automated matches [191142] (5 species)
    not a true protein
  7. 1748280Species Human (Homo sapiens) [TaxId:9606] [189274] (19 PDB entries)
  8. 1748284Domain d4wqpa_: 4wqp A: [269087]
    automated match to d1n83a_
    complexed with 3sx, so4

Details for d4wqpa_

PDB Entry: 4wqp (more details), 1.99 Å

PDB Description: crystal structure of rorc in complex with a benzyl sulfonamide inverse agonist
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d4wqpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wqpa_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaaf

SCOPe Domain Coordinates for d4wqpa_:

Click to download the PDB-style file with coordinates for d4wqpa_.
(The format of our PDB-style files is described here.)

Timeline for d4wqpa_: