Class a: All alpha proteins [46456] (286 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
Protein automated matches [191142] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189274] (19 PDB entries) |
Domain d4wqpa_: 4wqp A: [269087] automated match to d1n83a_ complexed with 3sx, so4 |
PDB Entry: 4wqp (more details), 1.99 Å
SCOPe Domain Sequences for d4wqpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wqpa_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaaf
Timeline for d4wqpa_: