Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (71 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188340] (51 PDB entries) |
Domain d4uuqa_: 4uuq A: [268960] automated match to d3hjua_ complexed with 64d |
PDB Entry: 4uuq (more details), 2.36 Å
SCOPe Domain Sequences for d4uuqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uuqa_ c.69.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sprrtpqsipyqdlphlvnadgqylfcrywkptgtpkalifvshgagehsgryeelarml mgldllvfahdhvghgqsegermvvsdfhvfvrdvlqhvdsmqkdypglpvfllghsmgg aiailtaaerpghfagmvlisplvlanpesattfkvlaakvlnlvlpnlslgpidssvls rnktevdiynsdplicraglkvcfgiqllnavsrveralpkltvpflllqgsadrlcdsk gayllmelaksqdktlkiyegayhvlhkelpevtnsvfheinmwvsqrta
Timeline for d4uuqa_: