Lineage for d4utaa1 (4uta A:1-297)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252195Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2252196Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2252241Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. 2252242Protein automated matches [227047] (6 species)
    not a true protein
  7. 2252251Species Dengue virus 2 [TaxId:11060] [268948] (2 PDB entries)
  8. 2252252Domain d4utaa1: 4uta A:1-297 [268956]
    Other proteins in same PDB: d4utaa2, d4utaa3, d4utab2, d4utab3, d4utal1, d4utal2, d4utam1, d4utam2
    automated match to d4gsxa1

Details for d4utaa1

PDB Entry: 4uta (more details), 3 Å

PDB Description: crystal structure of dengue 2 virus envelope glycoprotein in complex with the fab fragment of the broadly neutralizing human antibody ede1 c8
PDB Compounds: (A:) envelope glycoprotein E

SCOPe Domain Sequences for d4utaa1:

Sequence, based on SEQRES records: (download)

>d4utaa1 f.10.1.0 (A:1-297) automated matches {Dengue virus 2 [TaxId: 11060]}
mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
ieakltntttesrcptqgepslneeqdkrfickhsmvdrgwgngcglfgkggivtcakft
ckknmegkivqpenleytivitphsgeehavgndtgkhgkeikitpqsstteaeltgygt
vtmecsprtgldfnemvllqmedkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

Sequence, based on observed residues (ATOM records): (download)

>d4utaa1 f.10.1.0 (A:1-297) automated matches {Dengue virus 2 [TaxId: 11060]}
mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
ieakltntttesrcptqgepslneeqdkrfickhsmvdrgwgngcglfgkggivtcakft
ckknmegkivqpenleytivitphsgeehkhgkeikitpqsstteaeltgygtvtmecsp
rtgldfnemvllqmedkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtfknphakk
qdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

SCOPe Domain Coordinates for d4utaa1:

Click to download the PDB-style file with coordinates for d4utaa1.
(The format of our PDB-style files is described here.)

Timeline for d4utaa1: