SCOPe 2.05: Domain d4utcb2: 4utc B:298-395

Lineage for d4utcb2 (4utc B:298-395)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (43 species)
   not a true protein

7. Species Dengue virus 2 [TaxId:11060] [268950] (2 PDB entries)

8. Domain d4utcb2: 4utc B:298-395 [268951]
   Other proteins in same PDB: d4utca1, d4utcb1
   automated match to d4gsxa2

Details for d4utcb2

PDB Entry: 4utc, 3.08 Å

PDB Description: crystal structure of dengue 2 virus envelope glycoprotein

PDB Compounds: (B:) envelope glycoprotein E

SCOPe Domain Sequences for d4utcb2:

Sequence; same for both SEQRES and ATOM records:

>d4utcb2 b.1.18.0 (B:298-395) automated matches {Dengue virus 2 [TaxId: 11060]}
sysmctgkfkivkeiaetqhgtivirvqyegdgspckipfeitdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiivgvepgqlklnwlrpl

Timeline for d4utcb2:

• d4utcb2 is new in SCOPe 2.05-stable
  
• d4utcb2 appears in SCOPe 2.06
  
• d4utcb2 appears in the current release, SCOPe 2.08