Lineage for d4utcb1 (4utc B:1-297)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2576583Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 2576584Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families) (S)
  5. 2576629Family f.10.1.0: automated matches [227258] (1 protein)
    not a true family
  6. 2576630Protein automated matches [227047] (10 species)
    not a true protein
  7. 2576639Species Dengue virus 2 [TaxId:11060] [268948] (2 PDB entries)
  8. 2576643Domain d4utcb1: 4utc B:1-297 [268949]
    Other proteins in same PDB: d4utca2, d4utca3, d4utcb2, d4utcb3
    automated match to d4gsxa1

Details for d4utcb1

PDB Entry: 4utc (more details), 3.08 Å

PDB Description: crystal structure of dengue 2 virus envelope glycoprotein
PDB Compounds: (B:) envelope glycoprotein E

SCOPe Domain Sequences for d4utcb1:

Sequence, based on SEQRES records: (download)

>d4utcb1 f.10.1.0 (B:1-297) automated matches {Dengue virus 2 [TaxId: 11060]}
mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
ieakltntttesrcptqgepslneeqdkrfickhsmvdrgwgngcglfgkggivtcakft
ckknmegkivqpenleytivitphsgeehavgndtgkhgkeikitpqsstteaeltgygt
vtmecsprtgldfnemvllqmedkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

Sequence, based on observed residues (ATOM records): (download)

>d4utcb1 f.10.1.0 (B:1-297) automated matches {Dengue virus 2 [TaxId: 11060]}
mrcigisnrdfvegwvdivlehgscvttmaknkptldfelikteakqpatlrkycieakl
tntttesrcptqgepslneeqdkrfickhsmvdrgwgngcglfgkggivtcakftckknm
egkivqpenleytivitphsgeehavgndtgkhgkeikitpqsstteaeltgygtvtmec
sprtgldfnemvllqmedkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtfknpha
kkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

SCOPe Domain Coordinates for d4utcb1:

Click to download the PDB-style file with coordinates for d4utcb1.
(The format of our PDB-style files is described here.)

Timeline for d4utcb1: