SCOPe 2.08: Domain d4tvoa2: 4tvo A:158-330

Lineage for d4tvoa2 (4tvo A:158-330)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (47 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [268877] (2 PDB entries)

8. Domain d4tvoa2: 4tvo A:158-330 [268878]
   Other proteins in same PDB: d4tvoa1, d4tvoa3, d4tvob1
   automated match to d1bdma2
   complexed with na, so4

Details for d4tvoa2

PDB Entry: 4tvo, 1.5 Å

PDB Description: Structure of Malate Dehydrogenase from Mycobacterium tuberculosis

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d4tvoa2:

Sequence; same for both SEQRES and ATOM records:

>d4tvoa2 d.162.1.0 (A:158-330) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
trldhnraisqlaaktgaavtdikkmtiwgnhsatqypdlfhaevagknaaevvndqawi
edefiptvakrgaaiidargassaasaasatidaardwllgtpaddwvsmavvsdgsygv
peglissfpvttkggnwtivsgleidefsrgridkstaeladersavtelgli

Timeline for d4tvoa2:

• d4tvoa2 first appeared in SCOPe 2.05
  
• d4tvoa2 appears in SCOPe 2.07