Lineage for d4tu4a1 (4tu4 A:981-1108)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993781Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1993941Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1993942Protein automated matches [190615] (10 species)
    not a true protein
  7. 1993960Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries)
  8. 1994408Domain d4tu4a1: 4tu4 A:981-1108 [268870]
    Other proteins in same PDB: d4tu4a2
    automated match to d4tz2a_
    complexed with 37n, cl, dms, gol, so4

Details for d4tu4a1

PDB Entry: 4tu4 (more details), 1.73 Å

PDB Description: crystal structure of atad2a bromodomain complexed with 3-(3,5- dimethyl-1,2-oxazol-4-yl)-5-[(phenylsulfonyl)amino]benzoicacid
PDB Compounds: (A:) ATPase family AAA domain-containing protein 2

SCOPe Domain Sequences for d4tu4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tu4a1 a.29.2.0 (A:981-1108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qeedtfrelriflrnvthrlaidkrfrvftkpvdpdevpdyvtvikqpmdlssviskidl
hkyltvkdylrdidlicsnaleynpdrdpgdrlirhracalrdtayaiikeeldedfeql
ceeiqesr

SCOPe Domain Coordinates for d4tu4a1:

Click to download the PDB-style file with coordinates for d4tu4a1.
(The format of our PDB-style files is described here.)

Timeline for d4tu4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4tu4a2