Lineage for d4s1na_ (4s1n A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892510Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2892511Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2892629Family c.65.1.0: automated matches [191608] (1 protein)
    not a true family
  6. 2892630Protein automated matches [191110] (11 species)
    not a true protein
  7. 2892663Species Streptococcus pneumoniae [TaxId:170187] [268856] (1 PDB entry)
  8. 2892664Domain d4s1na_: 4s1n A: [268857]
    automated match to d3av3a_
    complexed with cl

Details for d4s1na_

PDB Entry: 4s1n (more details), 2.7 Å

PDB Description: the crystal structure of phosphoribosylglycinamide formyltransferase from streptococcus pneumoniae tigr4
PDB Compounds: (A:) phosphoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d4s1na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4s1na_ c.65.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
mkkiavfasgngsnfqviaeefpvefvfsdhrdayvlerakqlgvlsyafelkefeskad
yeaalvelleehqidlvclagymkivgptllsayegrivnihpaylpefpgahgiedawn
agvgqsgvtihwvdsgvdtgqvikqvrvprladdtidrfeariheaeyrlypevvkalft

SCOPe Domain Coordinates for d4s1na_:

Click to download the PDB-style file with coordinates for d4s1na_.
(The format of our PDB-style files is described here.)

Timeline for d4s1na_: