Lineage for d4s17a2 (4s17 A:106-478)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1925709Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 1925710Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 1925711Family d.128.1.1: Glutamine synthetase catalytic domain [55932] (2 proteins)
  6. 1925835Protein automated matches [268846] (1 species)
    not a true protein
  7. 1925836Species Bifidobacterium adolescentis [TaxId:367928] [268847] (1 PDB entry)
  8. 1925837Domain d4s17a2: 4s17 A:106-478 [268848]
    Other proteins in same PDB: d4s17a1, d4s17b1, d4s17c1, d4s17d1, d4s17e1, d4s17f1
    automated match to d1htqa2
    complexed with act, mg

Details for d4s17a2

PDB Entry: 4s17 (more details), 2.3 Å

PDB Description: the crystal structure of glutamine synthetase from bifidobacterium adolescentis atcc 15703
PDB Compounds: (A:) glutamine synthetase

SCOPe Domain Sequences for d4s17a2:

Sequence, based on SEQRES records: (download)

>d4s17a2 d.128.1.1 (A:106-478) automated matches {Bifidobacterium adolescentis [TaxId: 367928]}
srdprqvagkaeaylkstgiadtasfapeaeffifdkvrfensmqrsfyevdsieapwns
gidteddgtpniafknrvkkgyfpvppidhtqdlrddmvanlqkvglilershhevagag
qqeinyrfnslqhagddlmkykyvvhetaalagkaatfmpkpiagdngtgmhchqslwkd
gkplfydeknygglsdlarwyigglikhsssvlaftnpslnsyhrlvpgfeapvnlvysa
rnrsaairiplagtspaakriefrapdpscnpflafsaqlmagldgilnhieppapvdkd
lyelppeehagikqvpsslaeamdaleedhdfltagdvftddlidtwisikrgeidqarl
aptpleyelyfhi

Sequence, based on observed residues (ATOM records): (download)

>d4s17a2 d.128.1.1 (A:106-478) automated matches {Bifidobacterium adolescentis [TaxId: 367928]}
srdprqvagkaeaylkstgiadtasfapeaeffifdkvrfensmqrsfyevdsieapwns
gidteddgtpniafknrvkkgyfpvppidhtqdlrddmvanlqkvglilershhevagag
qqeinyrfnslqhagddlmkykyvvhetaalagkaatfmpkpiagdngtgmhchqslwkd
gkplfydeknygglsdlarwyigglikhsssvlaftnpslnsyhrlvpgapvnlvysarn
rsaairippaakriefrapdpscnpflafsaqlmagldgilnhieppapvagikqvpssl
aeamdaleedhdfltagdvftddlidtwisikrgeidqarlaptpleyelyfhi

SCOPe Domain Coordinates for d4s17a2:

Click to download the PDB-style file with coordinates for d4s17a2.
(The format of our PDB-style files is described here.)

Timeline for d4s17a2: