SCOPe 2.08: Domain d4rxma1: 4rxm A:23-311

Lineage for d4rxma1 (4rxm A:23-311)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   parallel beta-sheet of 6 strands, order 213456

4. Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families)
   Similar in architecture to the superfamily II but partly differs in topology

5. Family c.93.1.0: automated matches [191439] (1 protein)
   not a true family

6. Protein automated matches [190646] (77 species)
   not a true protein

7. Species Mannheimia haemolytica [TaxId:272629] [268809] (1 PDB entry)

8. Domain d4rxma1: 4rxm A:23-311 [268810]
   Other proteins in same PDB: d4rxma2
   automated match to d2ioya_
   complexed with asp, bgc, cl, ins

Details for d4rxma1

PDB Entry: 4rxm, 1.75 Å

PDB Description: crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol

PDB Compounds: (A:) Possible sugar ABC superfamily ATP binding cassette transporter, binding protein

SCOPe Domain Sequences for d4rxma1:

Sequence; same for both SEQRES and ATOM records:

>d4rxma1 c.93.1.0 (A:23-311) automated matches {Mannheimia haemolytica [TaxId: 272629]}
kdelvvfslpnlsspfevqlqkvavetskkleiklqvldgqssstkqasdlenaitrgak
giiispndvnaisgaveeiikekipaatldrkvesskpvphfgannytggqevakavkak
ypngakiilltgqpgstsniertkgirdelaaggdkykivvdqtgnwlrseglriiesvl
ptlkekpeviisanddmalgaiealrsqglkagdilvtgfdstpealarvkdgwlyltad
qrpsfavstaleqvvgnireskevsgadyppkiilkdnlqeaerfaeis

Timeline for d4rxma1:

• d4rxma1 first appeared in SCOPe 2.05, called d4rxma_
  
• d4rxma1 appears in SCOPe 2.07