Lineage for d4rqla_ (4rql A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1743740Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1743741Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1743742Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 1744216Protein automated matches [190068] (8 species)
    not a true protein
  7. 1744233Species Human (Homo sapiens) [TaxId:9606] [189507] (26 PDB entries)
  8. 1744244Domain d4rqla_: 4rql A: [268770]
    automated match to d3g5nc_
    complexed with cm5, edo, hem, sne

Details for d4rqla_

PDB Entry: 4rql (more details), 2.1 Å

PDB Description: crystal structure of a human cytochrome p450 2b6 (y226h/k262r) in complex with a monoterpene - sabinene
PDB Compounds: (A:) Cytochrome P450 2B6

SCOPe Domain Sequences for d4rqla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rqla_ a.104.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklppgprplpllgnllqmdrrgllksflrfrekygdvftvhlgprpvvmlcgveairea
lvdkaeafsgrgkiamvdpffrgygvifangnrwkvlrrfsvttmrdfgmgkrsveeriq
eeaqclieelrkskgalmdptflfqsitaniicsivfgkrfhyqdqeflkmlnlfyqtfs
lissvfgqlfelfsgflkhfpgahrqvyknlqeinayighsvekhretldpsaprdlidt
yllhmekeksnahsefshqnlnlntlslffagtettsttlrygfllmlkyphvaervyre
ieqvigphrppelhdrakmpyteaviyeiqrfsdllpmgvphivtqhtsfrgyiipkdte
vflilstalhdphyfekpdafnpdhfldangalkkteafipfslgkriclgegiaraelf
lffttilqnfsmaspvapedidltpqecgvgkipptyqirflprh

SCOPe Domain Coordinates for d4rqla_:

Click to download the PDB-style file with coordinates for d4rqla_.
(The format of our PDB-style files is described here.)

Timeline for d4rqla_:

  • d4rqla_ appears in periodic updates to SCOPe 2.05 starting on 2015-02-20
  • d4rqla_ is called d4rqla1 in SCOPe 2.06
  • d4rqla_ appears in the current release, SCOPe 2.07, called d4rqla1