SCOPe 2.08: Domain d4ri6b1: 4ri6 B:2-83

Lineage for d4ri6b1 (4ri6 B:2-83)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Populus tremula [TaxId:47664] [188794] (10 PDB entries)

8. Domain d4ri6b1: 4ri6 B:2-83 [268746]
   Other proteins in same PDB: d4ri6a2, d4ri6b2
   automated match to d1aw9a2
   complexed with gsh, mes

Details for d4ri6b1

PDB Entry: 4ri6, 1.52 Å

PDB Description: crystal structure of poplar glutathione transferase f1

PDB Compounds: (B:) Phi class glutathione transferase GSTF1

SCOPe Domain Sequences for d4ri6b1:

Sequence; same for both SEQRES and ATOM records:

>d4ri6b1 c.47.1.0 (B:2-83) automated matches {Populus tremula [TaxId: 47664]}
atpvtiygpplstavsrvlatliekdvpfhlipidlskgeqkkpeylkiqpfgqvpafkd
esitlfesraicryicdkyadk

Timeline for d4ri6b1:

• d4ri6b1 first appeared in SCOPe 2.05
  
• d4ri6b1 appears in SCOPe 2.07