Lineage for d4rgma1 (4rgm A:2-121)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2059068Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2059090Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 2059091Species Staphylococcus aureus [TaxId:1280] [50227] (18 PDB entries)
  8. 2059118Domain d4rgma1: 4rgm A:2-121 [268737]
    Other proteins in same PDB: d4rgma2, d4rgmb1, d4rgmb2, d4rgml1, d4rgml2, d4rgms2
    automated match to d3seba1

Details for d4rgma1

PDB Entry: 4rgm (more details), 2.69 Å

PDB Description: structure of staphylococcal enterotoxin b bound to the neutralizing antibody 20b1
PDB Compounds: (A:) enterotoxin type b

SCOPe Domain Sequences for d4rgma1:

Sequence, based on SEQRES records: (download)

>d4rgma1 b.40.2.2 (A:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvteh

Sequence, based on observed residues (ATOM records): (download)

>d4rgma1 b.40.2.2 (A:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfsrktcmyggvteh

SCOPe Domain Coordinates for d4rgma1:

Click to download the PDB-style file with coordinates for d4rgma1.
(The format of our PDB-style files is described here.)

Timeline for d4rgma1: