Lineage for d4rgns2 (4rgn S:122-238)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934366Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2934389Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 2934390Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries)
  8. 2934420Domain d4rgns2: 4rgn S:122-238 [268734]
    Other proteins in same PDB: d4rgna1, d4rgnb_, d4rgnc1, d4rgnc2, d4rgnd1, d4rgnd2, d4rgne1, d4rgne2, d4rgnf1, d4rgnf2, d4rgng1, d4rgng2, d4rgnh_, d4rgnl1, d4rgnl2, d4rgns1
    automated match to d1se4a2

Details for d4rgns2

PDB Entry: 4rgn (more details), 2.7 Å

PDB Description: structure of staphylococcal enterotoxin b bound to two neutralizing antibodies, 14g8 and 6d3
PDB Compounds: (S:) enterotoxin type b

SCOPe Domain Sequences for d4rgns2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rgns2 d.15.6.1 (S:122-238) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk

SCOPe Domain Coordinates for d4rgns2:

Click to download the PDB-style file with coordinates for d4rgns2.
(The format of our PDB-style files is described here.)

Timeline for d4rgns2: