SCOPe 2.05: Domain d4r69d2: 4r69 D:160-331

Lineage for d4r69d2 (4r69 D:160-331)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Lactate dehydrogenase [56339] (18 species)

7. Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (13 PDB entries)

8. Domain d4r69d2: 4r69 D:160-331 [268695]
   Other proteins in same PDB: d4r69a1, d4r69b1, d4r69c1, d4r69d1
   automated match to d4l4ra2
   complexed with epe, nai, so4, w13

Details for d4r69d2

PDB Entry: 4r69, 3.19 Å

PDB Description: Lactate Dehydrogenase in complex with inhibitor compound 13

PDB Compounds: (D:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4r69d2:

Sequence; same for both SEQRES and ATOM records:

>d4r69d2 d.162.1.1 (D:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

Timeline for d4r69d2:

• d4r69d2 is new in SCOPe 2.05-stable
  
• d4r69d2 appears in SCOPe 2.06
  
• d4r69d2 appears in the current release, SCOPe 2.08