Lineage for d4r3va_ (4r3v A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2528986Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2530179Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2530180Protein automated matches [190805] (17 species)
    not a true protein
  7. 2530324Species Tannerella forsythia [TaxId:203275] [268687] (1 PDB entry)
  8. 2530325Domain d4r3va_: 4r3v A: [268688]
    automated match to d1hv5e_
    complexed with ca, gol, zn

Details for d4r3va_

PDB Entry: 4r3v (more details), 2.01 Å

PDB Description: structure of karilysin propeptide and catalytic mmp domain
PDB Compounds: (A:) Karilysin

SCOPe Domain Sequences for d4r3va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r3va_ d.92.1.0 (A:) automated matches {Tannerella forsythia [TaxId: 203275]}
qrlydngpltgdnnyvlqgskwnkttlkyyiynssshlttterenairsafalwsdkstl
sfiqvynpnqadikikwekgnhgdgypfdgntgilahafypppaggnyaghlhfdgdenw
singsgidlitvaahaighllgiehsnvssalmypyytgikrqldnddclavwdlygyp

SCOPe Domain Coordinates for d4r3va_:

Click to download the PDB-style file with coordinates for d4r3va_.
(The format of our PDB-style files is described here.)

Timeline for d4r3va_: