Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein automated matches [254646] (36 species) not a true protein |
Species Influenza A virus, different strains [TaxId:11320] [255822] (42 PDB entries) |
Domain d4qy1b_: 4qy1 B: [268626] Other proteins in same PDB: d4qy1a_, d4qy1c_, d4qy1e_, d4qy1g_, d4qy1i_, d4qy1k_, d4qy1m_, d4qy1o_, d4qy1q_, d4qy1s_, d4qy1u_, d4qy1w_ automated match to d4d00d_ complexed with nag |
PDB Entry: 4qy1 (more details), 2.59 Å
SCOPe Domain Sequences for d4qy1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qy1b_ h.3.1.1 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]} glfgaiagflengwegmvdgwygfrhqnaqgtgqaadykstqaaidqitgklnrlvektn tefesiesefseiehqignvinwtkdsitdiwtyqaellvamenqhtidmadsemlnlye rvrkqlrqnaeedgkgcfeiyhacddscmesirnntydhsqyreeallnrlnin
Timeline for d4qy1b_: