Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein automated matches [190161] (23 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:1125630] [268559] (6 PDB entries) |
Domain d4pm6a_: 4pm6 A: [268571] automated match to d3hrea_ complexed with so4 |
PDB Entry: 4pm6 (more details), 1.56 Å
SCOPe Domain Sequences for d4pm6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pm6a_ e.3.1.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 1125630]} qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqse tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra qlvtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftq pqqnaesrrdvlasaariiaegl
Timeline for d4pm6a_: