Lineage for d4pm6a_ (4pm6 A:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013567Protein automated matches [190161] (29 species)
    not a true protein
  7. 3013874Species Klebsiella pneumoniae [TaxId:1125630] [268559] (6 PDB entries)
  8. 3013879Domain d4pm6a_: 4pm6 A: [268571]
    automated match to d3hrea_
    complexed with so4

Details for d4pm6a_

PDB Entry: 4pm6 (more details), 1.56 Å

PDB Description: crystal structure of ctx-m-14 s70g beta-lactamase at 1.56 angstroms resolution
PDB Compounds: (A:) beta-lactamase CTX-M-14

SCOPe Domain Sequences for d4pm6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pm6a_ e.3.1.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 1125630]}
qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqse
tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
qlvtwlkgnttgaasiraglptswtvgdktgsgdygttndiaviwpqgraplvlvtyftq
pqqnaesrrdvlasaariiaegl

SCOPe Domain Coordinates for d4pm6a_:

Click to download the PDB-style file with coordinates for d4pm6a_.
(The format of our PDB-style files is described here.)

Timeline for d4pm6a_: