SCOPe 2.06: Domain d4pmaa_: 4pma A:

Lineage for d4pmaa_ (4pma A:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (23 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:1125630] [268559] (6 PDB entries)

8. Domain d4pmaa_: 4pma A: [268568]
   automated match to d3hrea_
   complexed with so4

Details for d4pmaa_

PDB Entry: 4pma, 1.4 Å

PDB Description: crystal structure of ctx-m-14 s70g:s237a:r276a beta-lactamase at 1.39 angstroms resolution

PDB Compounds: (A:) beta-lactamase CTX-M-14

SCOPe Domain Sequences for d4pmaa_:

Sequence; same for both SEQRES and ATOM records:

>d4pmaa_ e.3.1.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 1125630]}
qtsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqse
tqkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggp
ggvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqra
qlvtwlkgnttgaasiraglptswtvgdktgagdygttndiaviwpqgraplvlvtyftq
pqqnaesradvlasaariiaegl

Timeline for d4pmaa_:

• d4pmaa_ first appeared in SCOPe 2.05
  
• d4pmaa_ appears in SCOPe 2.07
  
• d4pmaa_ appears in the current release, SCOPe 2.08