Lineage for d4pm9a_ (4pm9 A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949998Protein automated matches [190161] (23 species)
    not a true protein
  7. 1950160Species Klebsiella pneumoniae [TaxId:1125630] [268559] (6 PDB entries)
  8. 1950165Domain d4pm9a_: 4pm9 A: [268564]
    automated match to d1ylta_
    complexed with ce3

Details for d4pm9a_

PDB Entry: 4pm9 (more details), 1.45 Å

PDB Description: crystal structure of ctx-m-14 s70g:s237a:r276a beta-lactamase in complex with cefotaxime at 1.45 angstroms resolution
PDB Compounds: (A:) beta-lactamase CTX-M-14

SCOPe Domain Sequences for d4pm9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pm9a_ e.3.1.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 1125630]}
tsavqqklaalekssggrlgvalidtadntqvlyrgderfpmcgtskvmaaaavlkqset
qkqllnqpveikpadlvnynpiaekhvngtmtlaelsaaalqysdntamnkliaqlggpg
gvtafaraigdetfrldrteptlntaipgdprdtttpramaqtlrqltlghalgetqraq
lvtwlkgnttgaasiraglptswtvgdktgagdygttndiaviwpqgraplvlvtyftqp
qqnaesradvlasaariiaegl

SCOPe Domain Coordinates for d4pm9a_:

Click to download the PDB-style file with coordinates for d4pm9a_.
(The format of our PDB-style files is described here.)

Timeline for d4pm9a_: