SCOPe 2.08: Domain d4o1nf1: 4o1n F:13-101

Lineage for d4o1nf1 (4o1n F:13-101)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.0: automated matches [227133] (1 protein)
   not a true family

6. Protein automated matches [226834] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [226094] (8 PDB entries)

8. Domain d4o1nf1: 4o1n F:13-101 [268443]
   Other proteins in same PDB: d4o1na2, d4o1nb2, d4o1nc2, d4o1nd2, d4o1ne2, d4o1nf2
   automated match to d1m4va1
   complexed with gol

Details for d4o1nf1

PDB Entry: 4o1n, 2.5 Å

PDB Description: Crystal structure of Staphylococcal superantigen-like protein SAOUHSC_00383

PDB Compounds: (F:) Superantigen-like protein

SCOPe Domain Sequences for d4o1nf1:

Sequence; same for both SEQRES and ATOM records:

>d4o1nf1 b.40.2.0 (F:13-101) automated matches {Staphylococcus aureus [TaxId: 93061]}
qseselkhyynkpilerknvtgfkytdegkhylevtvgqqhsritllgsdkdkfkdgens
nidvfilregdsrqatnysiggvtksnsv

Timeline for d4o1nf1:

• d4o1nf1 first appeared in SCOPe 2.05
  
• d4o1nf1 appears in SCOPe 2.07