SCOPe 2.06: Domain d4o1ne2: 4o1n E:102-202

Lineage for d4o1ne2 (4o1n E:102-202)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.0: automated matches [227139] (1 protein)
   not a true family

6. Protein automated matches [226841] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [226096] (6 PDB entries)

8. Domain d4o1ne2: 4o1n E:102-202 [268441]
   Other proteins in same PDB: d4o1na1, d4o1nb1, d4o1nc1, d4o1nd1, d4o1ne1, d4o1nf1
   automated match to d2z8la2
   complexed with gol

Details for d4o1ne2

PDB Entry: 4o1n, 2.5 Å

PDB Description: Crystal structure of Staphylococcal superantigen-like protein SAOUHSC_00383

PDB Compounds: (E:) Superantigen-like protein

SCOPe Domain Sequences for d4o1ne2:

Sequence; same for both SEQRES and ATOM records:

>d4o1ne2 d.15.6.0 (E:102-202) automated matches {Staphylococcus aureus [TaxId: 93061]}
qyidyintpileikkdnedvlkdfyyiskedislkeldyrlreraikqhglysnglkqgq
ititmndgtthtidlsqklekermgesidgtkinkilvemk

Timeline for d4o1ne2:

• d4o1ne2 first appeared in SCOPe 2.05
  
• d4o1ne2 appears in SCOPe 2.07
  
• d4o1ne2 appears in the current release, SCOPe 2.08