Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.0: automated matches [227133] (1 protein) not a true family |
Protein automated matches [226834] (6 species) not a true protein |
Species Staphylococcus aureus [TaxId:93061] [226094] (8 PDB entries) |
Domain d4o1nc1: 4o1n C:14-101 [268431] Other proteins in same PDB: d4o1na2, d4o1nb2, d4o1nc2, d4o1nd2, d4o1ne2, d4o1nf2 automated match to d1m4va1 complexed with gol |
PDB Entry: 4o1n (more details), 2.5 Å
SCOPe Domain Sequences for d4o1nc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o1nc1 b.40.2.0 (C:14-101) automated matches {Staphylococcus aureus [TaxId: 93061]} seselkhyynkpilerknvtgfkytdegkhylevtvgqqhsritllgsdkdkfkdgensn idvfilregdsrqatnysiggvtksnsv
Timeline for d4o1nc1: