Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
Protein automated matches [190976] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188649] (54 PDB entries) |
Domain d4o00b1: 4o00 B:4-106 [268419] Other proteins in same PDB: d4o00a2, d4o00b2 automated match to d1bpva_ |
PDB Entry: 4o00 (more details), 1.85 Å
SCOPe Domain Sequences for d4o00b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o00b1 b.1.2.0 (B:4-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} erpsppvnltssdqtqssvqlkwepplkdggspilgyiierceegkdnwircnmklvpel tykvtglekgnkylyrvsaenkagvsdpseilgpltaddafve
Timeline for d4o00b1: