Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins) fold similar to that of the factor XIII catalytic domain automatically mapped to Pfam PF00797 |
Protein automated matches [190090] (5 species) not a true protein |
Species Mesorhizobium loti [TaxId:266835] [268407] (2 PDB entries) |
Domain d4nv7a_: 4nv7 A: [268412] automated match to d2bsza1 complexed with coa |
PDB Entry: 4nv7 (more details), 2.02 Å
SCOPe Domain Sequences for d4nv7a_:
Sequence, based on SEQRES records: (download)
>d4nv7a_ d.3.1.5 (A:) automated matches {Mesorhizobium loti [TaxId: 266835]} ppfdldaylarigytgprnasldtlkalhfahpqaipwenidpflgrpvrldlaalqdki vlggrggycfehnllfmhalkalgfevgglaarvlwgqsedaitarshmllrveldgrty iadvgfggltltaplllepgreqktphepfriveaddhfrlqaaiggdwrslyrfdlqpq yevdysvtnyflstsptshflssviaaraapdrryalrgnrlsihhlggrteqteiataa dladtlqgllgiiipdrtafeakvretkiv
>d4nv7a_ d.3.1.5 (A:) automated matches {Mesorhizobium loti [TaxId: 266835]} ppfdldaylarigytgprnasldtlkalhfahpqaipwenidpflgrpvrldlaalqdki vlggrggycfehnllfmhalkalgfevgglaarvlwgqdaitarshmllrveldgrtyia dvgfggltltaplllepgreqktphepfriveaddhfrlqaaiggdwrslyrfdlqpqye vdysvtnyflstsptshflssviaaraapdrryalrgnrlsihhlggrteqteiataadl adtlqgllgiiipdrtafeakvretkiv
Timeline for d4nv7a_: