SCOPe 2.08: Domain d4nv7b_: 4nv7 B:

Lineage for d4nv7b_ (4nv7 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins)
   fold similar to that of the factor XIII catalytic domain
   automatically mapped to Pfam PF00797

6. Protein automated matches [190090] (5 species)
   not a true protein

7. Species Mesorhizobium loti [TaxId:266835] [268407] (2 PDB entries)

8. Domain d4nv7b_: 4nv7 B: [268410]
   automated match to d2bsza1
   complexed with coa

Details for d4nv7b_

PDB Entry: 4nv7, 2.02 Å

PDB Description: Crystal Structure of Mesorhizobium Loti Arylamine N-acetyltransferase 1 In Complex With CoA

PDB Compounds: (B:) arylamine n-acetyltransferase

SCOPe Domain Sequences for d4nv7b_:

Sequence; same for both SEQRES and ATOM records:

>d4nv7b_ d.3.1.5 (B:) automated matches {Mesorhizobium loti [TaxId: 266835]}
ppfdldaylarigytgprnasldtlkalhfahpqaipwenidpflgrpvrldlaalqdki
vlggrggycfehnllfmhalkalgfevgglaarvlwgqsedaitarshmllrveldgrty
iadvgfggltltaplllepgreqktphepfriveaddhfrlqaaiggdwrslyrfdlqpq
yevdysvtnyflstsptshflssviaaraapdrryalrgnrlsihhlggrteqteiataa
dladtlqgllgiiipdrtafeakvretkiv

Timeline for d4nv7b_:

• d4nv7b_ first appeared in SCOPe 2.05
  
• d4nv7b_ appears in SCOPe 2.07