Lineage for d4ns3a_ (4ns3 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1875571Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 1875572Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 1875981Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 1875982Protein automated matches [190683] (38 species)
    not a true protein
  7. 1876244Species Mycobacterium tuberculosis [TaxId:83332] [225379] (7 PDB entries)
  8. 1876253Domain d4ns3a_: 4ns3 A: [268401]
    automated match to d4idma_
    complexed with b12, nad

Details for d4ns3a_

PDB Entry: 4ns3 (more details), 2.38 Å

PDB Description: crystal structure of the delta-pyrroline-5-carboxylate dehydrogenase from mycobacterium tuberculosis bound with nad and cobalamin
PDB Compounds: (A:) Delta-1-pyrroline-5-carboxylate dehydrogenase

SCOPe Domain Sequences for d4ns3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ns3a_ c.82.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
hmdaitqvpvpanepvhdyapkspertrlrtelasladhpidlphviggrhrmgdgerid
vvqphrhaarlgtltnathadaaaaveaamsaksdwaalpfderaavflraadllagpwr
ekiaaatmlgqsksvyqaeidavcelidfwrfnvafarqileqqpisgpgewnridyrpl
dgfvyaitpfnftsiagnlptapalmgntviwkpsitqtlaayltmqlleaaglppgvin
lvtgdgfavsdvaladprlagihftgstatfghlwqwvgtnigryhsyprlvgetggkdf
vvahasarpdvlrtalirgafdyqgqkcsavsrafiahsvwqrmgdellakaaelrygdi
tdlsnyggalidqrafvknvdaierakgaaavtvavggeyddsegyfvrptvllsddptd
esfvieyfgpllsvhvypderyeqildvidtgsryaltgaviaddrqavltaldrlrfaa
gnfyvndkptgavvgrqpfggargsdtndkagsplnllrwtsarsiketfvaatdhiyph
ma

SCOPe Domain Coordinates for d4ns3a_:

Click to download the PDB-style file with coordinates for d4ns3a_.
(The format of our PDB-style files is described here.)

Timeline for d4ns3a_:

  • d4ns3a_ appears in periodic updates to SCOPe 2.05 starting on 2015-02-20
  • d4ns3a_ is called d4ns3a1 in SCOPe 2.06
  • d4ns3a_ appears in the current release, SCOPe 2.07, called d4ns3a1