Lineage for d4mv3a3 (4mv3 A:331-445)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1808932Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1809035Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 1809160Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 1809161Protein automated matches [254496] (11 species)
    not a true protein
  7. 1809187Species Haemophilus influenzae [TaxId:71421] [268355] (8 PDB entries)
  8. 1809189Domain d4mv3a3: 4mv3 A:331-445 [268376]
    Other proteins in same PDB: d4mv3a1, d4mv3a2
    automated match to d2w6za3
    complexed with acp, bct, edo

Details for d4mv3a3

PDB Entry: 4mv3 (more details), 1.69 Å

PDB Description: crystal structure of biotin carboxylase from haemophilus influenzae in complex with amppcp and bicarbonate
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d4mv3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mv3a3 b.84.2.0 (A:331-445) automated matches {Haemophilus influenzae [TaxId: 71421]}
kghamecrinaedpktflpspgkvnhlhspgglgvrwdshvyggytvpphydsmiaklit
ygdtrevairrmqnalsetiidgiktniplheliledenfqkggtnihylekklg

SCOPe Domain Coordinates for d4mv3a3:

Click to download the PDB-style file with coordinates for d4mv3a3.
(The format of our PDB-style files is described here.)

Timeline for d4mv3a3: