Class b: All beta proteins [48724] (177 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) |
Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
Protein automated matches [254496] (13 species) not a true protein |
Species Haemophilus influenzae [TaxId:71421] [268355] (8 PDB entries) |
Domain d4mv6a3: 4mv6 A:331-444 [268360] Other proteins in same PDB: d4mv6a1, d4mv6a2 automated match to d2w6za3 complexed with edo, pct |
PDB Entry: 4mv6 (more details), 1.77 Å
SCOPe Domain Sequences for d4mv6a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mv6a3 b.84.2.0 (A:331-444) automated matches {Haemophilus influenzae [TaxId: 71421]} kghamecrinaedpktflpspgkvnhlhspgglgvrwdshvyggytvpphydsmiaklit ygdtrevairrmqnalsetiidgiktniplheliledenfqkggtnihylekkl
Timeline for d4mv6a3: