SCOPe 2.05: Domain d4mv8a1: 4mv8 A:1-114

Lineage for d4mv8a1 (4mv8 A:1-114)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (9 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (28 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:71421] [268351] (8 PDB entries)

8. Domain d4mv8a1: 4mv8 A:1-114 [268352]
   Other proteins in same PDB: d4mv8a2, d4mv8a3
   automated match to d3rv3a1
   complexed with acp, po4

Details for d4mv8a1

PDB Entry: 4mv8, 2.06 Å

PDB Description: crystal structure of biotin carboxylase from haemophilus influenzae in complex with amppcp and phosphate

PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d4mv8a1:

Sequence; same for both SEQRES and ATOM records:

>d4mv8a1 c.30.1.0 (A:1-114) automated matches {Haemophilus influenzae [TaxId: 71421]}
mlekvvianrgeialrilrackelgiktvavhstadrdlkhvlladeticigpapsaksy
lnipaiiaaaevtgadaihpgygflsenadfaeqversgftfigptadvirlmg

Timeline for d4mv8a1:

• d4mv8a1 is new in SCOPe 2.05-stable
  
• d4mv8a1 appears in SCOPe 2.06
  
• d4mv8a1 appears in the current release, SCOPe 2.08