Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
Protein Uridine phosphorylase [53176] (6 species) |
Species Vibrio cholerae [TaxId:243277] [224899] (19 PDB entries) |
Domain d4lzwa_: 4lzw A: [268324] automated match to d4k6oa_ complexed with cl, edo, eoh, mg, na, thm |
PDB Entry: 4lzw (more details), 1.29 Å
SCOPe Domain Sequences for d4lzwa_:
Sequence, based on SEQRES records: (download)
>d4lzwa_ c.56.2.1 (A:) Uridine phosphorylase {Vibrio cholerae [TaxId: 243277]} ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipdhatlketearsik vvveaarkmlk
>d4lzwa_ c.56.2.1 (A:) Uridine phosphorylase {Vibrio cholerae [TaxId: 243277]} ktvfhlgvteadlngatlaiipgdparvqkiaelmdnpvflashreytvyraeldgqsvv vcstgiggpstsiaveelaqlgvrtflrvgttgaiqphvnvgdmivttgsvrldgaslhf apmefpavpdfdvatamkaaaqesgatvhmgvtassdtfypgqerydtftgrvvrrfqgs mkewqdmgvlnfemesatlltmcassglkagcvagviinrtqkeipetearsikvvveaa rkmlk
Timeline for d4lzwa_: