SCOPe 2.08: Domain d4co7b1: 4co7 B:1-117

Lineage for d4co7b1 (4co7 B:1-117)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.3: GABARAP-like [54253] (4 proteins)
   intracellular membrane trafficking and fusion proteins
   automatically mapped to Pfam PF02991

6. Protein automated matches [190358] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187279] (33 PDB entries)

8. Domain d4co7b1: 4co7 B:1-117 [268236]
   Other proteins in same PDB: d4co7a2, d4co7b2
   automated match to d3dowa_

Details for d4co7b1

PDB Entry: 4co7, 2 Å

PDB Description: crystal structure of human gate-16

PDB Compounds: (B:) gamma-aminobutyric acid receptor-associated protein-like 2

SCOPe Domain Sequences for d4co7b1:

Sequence; same for both SEQRES and ATOM records:

>d4co7b1 d.15.1.3 (B:1-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mkwmfkedhslehrcvesakirakypdrvpvivekvsgsqivdidkrkylvpsditvaqf
mwiirkriqlpsekaiflfvdktvpqssltmgqlyekekdedgflyvaysgentfgf

Timeline for d4co7b1:

• d4co7b1 first appeared in SCOPe 2.05, called d4co7b_
  
• d4co7b1 appears in SCOPe 2.07