SCOPe 2.05: Domain d4c5aa2: 4c5a A:97-306

Lineage for d4c5aa2 (4c5a A:97-306)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families)

5. Family d.142.1.1: ATP-binding domain of peptide synthetases [56060] (4 proteins)

6. Protein automated matches [268128] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [268129] (3 PDB entries)

8. Domain d4c5aa2: 4c5a A:97-306 [268136]
   Other proteins in same PDB: d4c5aa1, d4c5ab1
   automated match to d1iova2
   complexed with adp, ds0, gol, mg

Details for d4c5aa2

PDB Entry: 4c5a, 1.65 Å

PDB Description: the x-ray crystal structures of d-alanyl-d-alanine ligase in complex adp and d-cycloserine phosphate

PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4c5aa2:

Sequence; same for both SEQRES and ATOM records:

>d4c5aa2 d.142.1.1 (A:97-306) automated matches {Escherichia coli [TaxId: 83333]}
klrskllwqgaglpvapwvaltraefekglsdkqlaeisalglpvivkpsregssvgmsk
vvaenalqdalrlafqhdeevliekwlsgpeftvailgeeilpsiriqpsgtfydyeaky
lsdetqyfcpagleasqeanlqalvlkawttlgckgwgridvmldsdgqfylleantspg
mtshslvpmaarqagmsfsqlvvrilelad

Timeline for d4c5aa2:

• d4c5aa2 is new in SCOPe 2.05-stable
  
• d4c5aa2 appears in SCOPe 2.06
  
• d4c5aa2 appears in the current release, SCOPe 2.08