SCOPe 2.08: Domain d4c5bb1: 4c5b B:1-96

Lineage for d4c5bb1 (4c5b B:1-96)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [268126] (3 PDB entries)

8. Domain d4c5bb1: 4c5b B:1-96 [268127]
   Other proteins in same PDB: d4c5ba2, d4c5bb2
   automated match to d1iowa1
   complexed with adp, co3, dal, gol, imd, mg

Details for d4c5bb1

PDB Entry: 4c5b, 1.5 Å

PDB Description: the x-ray crystal structure of d-alanyl-d-alanine ligase in complex with atp and d-ala-d-ala

PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4c5bb1:

Sequence; same for both SEQRES and ATOM records:

>d4c5bb1 c.30.1.0 (B:1-96) automated matches {Escherichia coli [TaxId: 83333]}
mtdkiavllggtsaerevslnsgaavlaglreggidaypvdpkevdvtqlksmgfqkvfi
alhgrggedgtlqgmlelmglpytgsgvmasalsmd

Timeline for d4c5bb1:

• d4c5bb1 first appeared in SCOPe 2.05
  
• d4c5bb1 appears in SCOPe 2.07