Lineage for d3x15j_ (3x15 J:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1720291Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1720292Protein automated matches [190453] (18 species)
    not a true protein
  7. 1720295Species Aquifex aeolicus [TaxId:224324] [268117] (1 PDB entry)
  8. 1720299Domain d3x15j_: 3x15 J: [268122]
    automated match to d2zxya_
    complexed with hec

Details for d3x15j_

PDB Entry: 3x15 (more details), 1.6 Å

PDB Description: dimeric aquifex aeolicus cytochrome c555
PDB Compounds: (J:) cytochrome c552

SCOPe Domain Sequences for d3x15j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3x15j_ a.3.1.0 (J:) automated matches {Aquifex aeolicus [TaxId: 224324]}
adgkaifqqkgcgschqanvdtvgpslkkiaqayagkedqlikflkgeapaivdpakeai
mkpqltmlkglsdaelkaladfilshk

SCOPe Domain Coordinates for d3x15j_:

Click to download the PDB-style file with coordinates for d3x15j_.
(The format of our PDB-style files is described here.)

Timeline for d3x15j_: