Lineage for d3wyaa3 (3wya A:317-427)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2063485Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2063486Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2063593Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2063594Protein automated matches [254425] (16 species)
    not a true protein
  7. 2063644Species Pyrococcus horikoshii OT3 [TaxId:70601] [268115] (1 PDB entry)
  8. 2063645Domain d3wyaa3: 3wya A:317-427 [268116]
    Other proteins in same PDB: d3wyaa1, d3wyaa2
    automated match to d3wxme3
    complexed with gdp

Details for d3wyaa3

PDB Entry: 3wya (more details), 2.35 Å

PDB Description: crystal structure of gdp-bound ef1alpha from pyrococcus horikoshii
PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d3wyaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wyaa3 b.44.1.0 (A:317-427) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
vrtkdtfkaqiivlnhptaitvgyspvlhahtaqipvrfeqilakvdprtgniveenpqf
iktgdsaivvlrpmkpvvlepvkeipqlgrfairdmgmtiaagmvisiqkg

SCOPe Domain Coordinates for d3wyaa3:

Click to download the PDB-style file with coordinates for d3wyaa3.
(The format of our PDB-style files is described here.)

Timeline for d3wyaa3: