Class b: All beta proteins [48724] (177 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
Protein automated matches [254425] (16 species) not a true protein |
Species Pyrococcus horikoshii OT3 [TaxId:70601] [268115] (1 PDB entry) |
Domain d3wyaa3: 3wya A:317-427 [268116] Other proteins in same PDB: d3wyaa1, d3wyaa2 automated match to d3wxme3 complexed with gdp |
PDB Entry: 3wya (more details), 2.35 Å
SCOPe Domain Sequences for d3wyaa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wyaa3 b.44.1.0 (A:317-427) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} vrtkdtfkaqiivlnhptaitvgyspvlhahtaqipvrfeqilakvdprtgniveenpqf iktgdsaivvlrpmkpvvlepvkeipqlgrfairdmgmtiaagmvisiqkg
Timeline for d3wyaa3: