SCOPe 2.08: Domain d3wyqa_: 3wyq A:

Lineage for d3wyqa_ (3wyq A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries)

8. Domain d3wyqa_: 3wyq A: [268112]
   automated match to d1n9mc_
   complexed with btn, gol, so4; mutant

Details for d3wyqa_

PDB Entry: 3wyq, 1 Å

PDB Description: crystal structure of the low-immunogenic core streptavidin mutant lisa-314 (y22s/y83s/r84k/e101d/r103k/e116n) at 1.0 a resolution

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d3wyqa_:

Sequence; same for both SEQRES and ATOM records:

>d3wyqa_ b.61.1.1 (A:) automated matches {Streptomyces avidinii [TaxId: 1895]}
aeagitgtwsnqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgta
lgwtvawknnsknahsattwsgqyvggadakintqwlltsgttnanawkstlvghdtftk
vk

Timeline for d3wyqa_:

• d3wyqa_ first appeared in SCOPe 2.05
  
• d3wyqa_ appears in SCOPe 2.07