SCOPe 2.06: Domain d3wxoa2: 3wxo A:430-720

Lineage for d3wxoa2 (3wxo A:430-720)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.0: automated matches [191605] (1 protein)
   not a true family

6. Protein automated matches [191104] (11 species)
   not a true protein

7. Species Synechococcus elongatus [TaxId:1140] [237745] (3 PDB entries)

8. Domain d3wxoa2: 3wxo A:430-720 [268108]
   automated match to d3wnua2
   complexed with hem, na, niz

Details for d3wxoa2

PDB Entry: 3wxo, 2.12 Å

PDB Description: Crystal structure of isoniazid bound KatG catalase peroxidase from Synechococcus elongatus PCC7942

PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d3wxoa2:

Sequence; same for both SEQRES and ATOM records:

>d3wxoa2 a.93.1.0 (A:430-720) automated matches {Synechococcus elongatus [TaxId: 1140]}
liwqdpipagnrnydvqavkdriaasglsiselvstawdsartyrnsdkrggangarirl
apqkdwegnepdrlakvlavlegiaaatgasvadvivlagnvgveqaaraagveivlpfa
pgrgdataeqtdtesfavlepihdgyrnwlkqdyaatpeellldrtqllgltapemtvli
gglrvlgtnhggtkhgvftdregvltndffvnltdmnylwkpagknlyeicdrktnqvkw
tatrvdlvfgsnsilrayselyaqddnkekfvrdfvaawtkvmnadrfdld

Timeline for d3wxoa2:

• d3wxoa2 first appeared in SCOPe 2.05
  
• d3wxoa2 appears in SCOPe 2.07
  
• d3wxoa2 appears in the current release, SCOPe 2.08