SCOPe 2.05: Domain d3wyaa1: 3wya A:5-215

Lineage for d3wyaa1 (3wya A:5-215)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [268084] (1 PDB entry)

8. Domain d3wyaa1: 3wya A:5-215 [268101]
   Other proteins in same PDB: d3wyaa2, d3wyaa3
   automated match to d3wxme1
   complexed with gdp

Details for d3wyaa1

PDB Entry: 3wya, 2.35 Å

PDB Description: crystal structure of gdp-bound ef1alpha from pyrococcus horikoshii

PDB Compounds: (A:) Elongation factor 1-alpha

SCOPe Domain Sequences for d3wyaa1:

Sequence, based on SEQRES records:

>d3wyaa1 c.37.1.0 (A:5-215) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
kphvnivfighvdhgksttigrllydtgnipetiikkfeemgekgksfkfawvmdrlkee
rergitidvahtkfetphryitiidapghrdfvknmitgasqadaavlvvaatdgvmpqt
kehaflartlgikhiivtinkmdmvnydqkvfekvkaqvekllktlgykdfpviptsawn
gdnvvkksdkmpwyngptliealdqipepek

Sequence, based on observed residues (ATOM records):

>d3wyaa1 c.37.1.0 (A:5-215) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
kphvnivfighvdhgksttigrllydtgnipkfawvmdrlkeehtkfetphryitiidap
ghrdfvknmitgasqadaavlvvaatdgvmpqtkehaflartlgikhiivtinkmdmvny
dqkvfekvkaqvekllktlgykdfpviptsawngdnvvkksdkmpwyngptliealdqip
epek

Timeline for d3wyaa1:

• d3wyaa1 is new in SCOPe 2.05-stable
  
• d3wyaa1 appears in SCOPe 2.06
  
• d3wyaa1 appears in the current release, SCOPe 2.08