Lineage for d3wypd_ (3wyp D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2805786Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2805787Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2805788Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2805820Protein Streptavidin [50878] (1 species)
  7. 2805821Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)
  8. 2805852Domain d3wypd_: 3wyp D: [268098]
    automated match to d1mk5a_
    complexed with bso, btn, gol, so4

Details for d3wypd_

PDB Entry: 3wyp (more details), 1.3 Å

PDB Description: crystal structure of wild-type core streptavidin in complex with d- biotin/biotin-d-sulfoxide at 1.3 a resolution
PDB Compounds: (D:) streptavidin

SCOPe Domain Sequences for d3wypd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wypd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
kp

SCOPe Domain Coordinates for d3wypd_:

Click to download the PDB-style file with coordinates for d3wypd_.
(The format of our PDB-style files is described here.)

Timeline for d3wypd_: