Lineage for d3wihl1 (3wih L:1-107)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2034696Domain d3wihl1: 3wih L:1-107 [268069]
    Other proteins in same PDB: d3wiha_, d3wihb_, d3wihl2, d3wihm2
    automated match to d2v7ha1
    complexed with gol

Details for d3wihl1

PDB Entry: 3wih (more details), 1.7 Å

PDB Description: crystal structure of the third fibronectin domain (fn3) of human robo1 in complex with the fab fragment of murine monoclonal antibody b2212a.
PDB Compounds: (L:) anti-human ROBO1 antibody B2212A Fab light chain

SCOPe Domain Sequences for d3wihl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wihl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscrasqdisnflnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgtdfsltiskleqediatyfcqqgntlpltfgagtklelk

SCOPe Domain Coordinates for d3wihl1:

Click to download the PDB-style file with coordinates for d3wihl1.
(The format of our PDB-style files is described here.)

Timeline for d3wihl1: