SCOPe 2.05: Domain d3wihl1: 3wih L:1-107

Lineage for d3wihl1 (3wih L:1-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d3wihl1: 3wih L:1-107 [268069]
   Other proteins in same PDB: d3wiha_, d3wihb_, d3wihl2, d3wihm2
   automated match to d2v7ha1
   complexed with gol

Details for d3wihl1

PDB Entry: 3wih, 1.7 Å

PDB Description: crystal structure of the third fibronectin domain (fn3) of human robo1 in complex with the fab fragment of murine monoclonal antibody b2212a.

PDB Compounds: (L:) anti-human ROBO1 antibody B2212A Fab light chain

SCOPe Domain Sequences for d3wihl1:

Sequence; same for both SEQRES and ATOM records:

>d3wihl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqttsslsaslgdrvtiscrasqdisnflnwyqqkpdgtvklliyytsrlhsgvps
rfsgsgsgtdfsltiskleqediatyfcqqgntlpltfgagtklelk

Timeline for d3wihl1:

• d3wihl1 is new in SCOPe 2.05-stable
  
• d3wihl1 appears in SCOPe 2.06
  
• d3wihl1 appears in the current release, SCOPe 2.08