Lineage for d3wnwd_ (3wnw D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1991631Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1991632Protein automated matches [190036] (39 species)
    not a true protein
  7. 1991832Species Mouse (Mus musculus) [TaxId:10090] [268023] (1 PDB entry)
  8. 1991836Domain d3wnwd_: 3wnw D: [268043]
    automated match to d3vnxa_
    complexed with fe, gol, k, mg

Details for d3wnwd_

PDB Entry: 3wnw (more details), 2.24 Å

PDB Description: Structure of Mouse H-chain modified ferritin
PDB Compounds: (D:) ferritin heavy chain

SCOPe Domain Sequences for d3wnwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wnwd_ a.25.1.0 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlg

SCOPe Domain Coordinates for d3wnwd_:

Click to download the PDB-style file with coordinates for d3wnwd_.
(The format of our PDB-style files is described here.)

Timeline for d3wnwd_: